NOB1 Antibody - C-terminal region : HRP

NOB1 Antibody - C-terminal region : HRP
SKU
AVIARP54976_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NOB1 may play a role in mRNA degradation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NOB1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: RNA-binding protein NOB1

Protein Size: 412

Purification: Affinity Purified
More Information
SKU AVIARP54976_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54976_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 28987
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×