NODAL Antibody - N-terminal region : FITC

NODAL Antibody - N-terminal region : FITC
SKU
AVIARP57099_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NODAL

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nodal homolog

Protein Size: 347

Purification: Affinity Purified
More Information
SKU AVIARP57099_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57099_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4838
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×