Nppc Antibody - C-terminal region : HRP

Nppc Antibody - C-terminal region : HRP
SKU
AVIARP57660_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the natriuretic peptide family. Natriuretic peptides are involved in the control of blood pressure, extracellular fluid volume and electrolyte homeostasis. The encoded protein also plays a role in sensory neuron bifurcation, and is a critical regulator of endochondral bone growth. The encoded protein is a ligand for the natriuretic peptide receptor B, and is synthesized as a preprohormone which is cleaved to produce a mature peptide. Mutations in this gene are associated with dwarfism resulting from impaired endochondral ossification.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Nppc

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: C-type natriuretic peptide

Protein Size: 126

Purification: Affinity Purified
More Information
SKU AVIARP57660_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57660_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18159
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×