NPTX2 Antibody - N-terminal region : FITC

NPTX2 Antibody - N-terminal region : FITC
SKU
AVIARP56365_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPTX2

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuronal pentraxin-2

Protein Size: 431

Purification: Affinity Purified
More Information
SKU AVIARP56365_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56365_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4885
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×