NRARP Antibody - middle region : FITC

NRARP Antibody - middle region : FITC
SKU
AVIARP56166_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NRARP may play a role in the formation of somites.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRARP

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Notch-regulated ankyrin repeat-containing protein

Protein Size: 114

Purification: Affinity Purified
More Information
SKU AVIARP56166_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56166_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 441478
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×