NRARP Antibody - middle region : HRP

NRARP Antibody - middle region : HRP
SKU
AVIARP56166_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NRARP may play a role in the formation of somites.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRARP

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Notch-regulated ankyrin repeat-containing protein

Protein Size: 114

Purification: Affinity Purified
More Information
SKU AVIARP56166_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56166_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 441478
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×