NRBP1 Antibody - C-terminal region : Biotin

NRBP1 Antibody - C-terminal region : Biotin
SKU
AVIARP54950_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human NRBP1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: nuclear receptor-binding protein

Protein Size: 543

Purification: Affinity Purified
More Information
SKU AVIARP54950_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54950_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29959
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×