NRL Antibody - C-terminal region : FITC

NRL Antibody - C-terminal region : FITC
SKU
AVIARP58167_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neural retina-specific leucine zipper protein

Protein Size: 237

Purification: Affinity Purified
More Information
SKU AVIARP58167_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58167_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4901
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×