NSMCE3 Antibody - middle region : Biotin

NSMCE3 Antibody - middle region : Biotin
SKU
AVIARP57727_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is part of the SMC5-6 chromatin reorganizing complex and is a member of the MAGE superfamily. This is an intronless gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDNL2

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: non-structural maintenance of chromosomes element 3 homolog

Protein Size: 304

Purification: Affinity Purified
More Information
SKU AVIARP57727_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57727_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56160
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×