NT5DC1 Antibody - N-terminal region : FITC

NT5DC1 Antibody - N-terminal region : FITC
SKU
AVIARP55511_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of NT5DC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5DC1

Key Reference: Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 5'-nucleotidase domain-containing protein 1

Protein Size: 455

Purification: Affinity Purified
More Information
SKU AVIARP55511_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55511_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221294
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×