Ntf3 Antibody - N-terminal region : Biotin

Ntf3 Antibody - N-terminal region : Biotin
SKU
AVIARP56367_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ntf3 is a neuronal survival protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Ntf3

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neurotrophin-3

Protein Size: 258

Purification: Affinity Purified
More Information
SKU AVIARP56367_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56367_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 81737
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×