NUBP1 Antibody - N-terminal region : Biotin

NUBP1 Antibody - N-terminal region : Biotin
SKU
AVIARP56355_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: NUBP1 is a member of the NUBP/MRP subfamily of ATP-binding proteins (Nakashima et al., 1999 [PubMed 10486206]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NUBP1

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic Fe-S cluster assembly factor NUBP1

Protein Size: 320

Purification: Affinity Purified
More Information
SKU AVIARP56355_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56355_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4682
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×