NUDCD3 Antibody - middle region : HRP

NUDCD3 Antibody - middle region : HRP
SKU
AVIARP55233_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUDCD3

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NudC domain-containing protein 3

Protein Size: 361

Purification: Affinity Purified
More Information
SKU AVIARP55233_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55233_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23386
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×