NUP155 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NUP155

Molecular Weight: 147kDa

Peptide Sequence: Synthetic peptide located within the following region: YPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nuclear pore complex protein Nup155

Protein Size: 1332

Purification: Affinity Purified

• SKU: AVIARP53619_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53619_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9631
• Host: Rabbit
• Conjugate: Conjugated, HRP