OAZ2 Antibody - middle region : FITC

OAZ2 Antibody - middle region : FITC
SKU
AVIARP56372_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. The ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OAZ2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ornithine decarboxylase antizyme 2

Protein Size: 189

Purification: Affinity Purified
More Information
SKU AVIARP56372_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56372_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4947
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×