Odf1 Antibody - middle region : Biotin

Odf1 Antibody - middle region : Biotin
SKU
AVIARP53765_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Odf1 is a component of the outer dense fibers (ODF) of spermatozoa. ODF are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail and may help to maintain the passive elastic structures and elastic recoil of the sperm tail.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: VCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Outer dense fiber protein 1

Protein Size: 247

Purification: Affinity Purified
More Information
SKU AVIARP53765_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53765_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18285
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×