ODF2 Antibody - N-terminal region : Biotin

ODF2 Antibody - N-terminal region : Biotin
SKU
AVIARP53831_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ODF2

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cDNA FLJ56030, highly similar to Homo sapiens outer dense fiber of sperm tails 2 (ODF2), transcript variant 2, mRNA EMBL BAG63297.1

Protein Size: 638

Purification: Affinity Purified
More Information
SKU AVIARP53831_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53831_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4957
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×