OLAH Antibody - N-terminal region : FITC

OLAH Antibody - N-terminal region : FITC
SKU
AVIARP56263_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLAH

Key Reference: Nakamura,N., (2006) DNA Res. 13 (4), 169-183

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: S-acyl fatty acid synthase thioesterase, medium chain

Protein Size: 265

Purification: Affinity Purified
More Information
SKU AVIARP56263_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56263_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55301
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×