OLFML1 Antibody - N-terminal region : FITC

OLFML1 Antibody - N-terminal region : FITC
SKU
AVIARP55873_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLFML1

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: IYQRFRVLEQGLEKCTQATRAYIQEFQEFSKNISVMLGRCQTYTSEYKSA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactomedin-like protein 1

Protein Size: 402

Purification: Affinity Purified
More Information
SKU AVIARP55873_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55873_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283298
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×