Omp Antibody - C-terminal region : Biotin

Omp Antibody - C-terminal region : Biotin
SKU
AVIARP56669_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Omp may act as a modulator of the olfactory signal-transduction cascade.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: EDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactory marker protein

Protein Size: 163

Purification: Affinity Purified
More Information
SKU AVIARP56669_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56669_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18378
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×