OPA1 Antibody - N-terminal region : HRP

OPA1 Antibody - N-terminal region : HRP
SKU
AVIARP57715_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: SPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial dynamin-like 120 kDa protein EMBL ADP90061.1

Protein Size: 924

Purification: Affinity Purified
More Information
SKU AVIARP57715_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57715_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4976
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×