OSGEP Antibody - middle region : Biotin

OSGEP Antibody - middle region : Biotin
SKU
AVIARP57038_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: O-sialoglycoprotein endopeptidases specifically cleave the polypeptide backbone of membrane glycoproteins that contain clusters of O-linked sialoglycans.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OSGEP

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable tRNA threonylcarbamoyladenosine biosynthesis protein OSGEP

Protein Size: 335

Purification: Affinity Purified
More Information
SKU AVIARP57038_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57038_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55644
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×