OTUD6B Antibody - middle region : HRP

OTUD6B Antibody - middle region : HRP
SKU
AVIARP56809_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUD6B

Key Reference: Worby,C.A. (2002) Nat. Rev. Mol. Cell Biol. 3 (12), 919-931

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: OTU domain-containing protein 6B

Protein Size: 323

Purification: Affinity Purified
More Information
SKU AVIARP56809_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56809_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51633
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×