PANK4 Antibody - N-terminal region : HRP

PANK4 Antibody - N-terminal region : HRP
SKU
AVIARP57155_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PANK4

Key Reference: 0

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pantothenate kinase 4

Protein Size: 773

Purification: Affinity Purified
More Information
SKU AVIARP57155_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57155_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55229
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×