PAOX Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. P

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAOX

Key Reference: Jarvinen,A., (2006) J. Biol. Chem. 281 (8), 4589-4595

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxisomal N(1)-acetyl-spermine/spermidine oxidase

Protein Size: 511

Purification: Affinity Purified

• SKU: AVIARP53827_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53827_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 196743
• Host: Rabbit
• Conjugate: Conjugated, Biotin