PARVG Antibody - N-terminal region : HRP

PARVG Antibody - N-terminal region : HRP
SKU
AVIARP57609_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Members of the parvin family, including PARVG, are actin-binding proteins associated with focal contacts.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARVG

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Gamma-parvin

Protein Size: 187

Purification: Affinity Purified
More Information
SKU AVIARP57609_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57609_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64098
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×