PCCB Antibody - middle region : Biotin

PCCB Antibody - middle region : Biotin
SKU
AVIARP56116_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCCB

Key Reference: Desviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Propionyl-CoA carboxylase beta chain, mitochondrial

Protein Size: 539

Purification: Affinity Purified
More Information
SKU AVIARP56116_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56116_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5096
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×