PCOLCE Antibody - middle region : HRP

PCOLCE Antibody - middle region : HRP
SKU
AVIARP56378_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCOLCE

Key Reference: Grgurevic,L., (2007) Int Orthop 31 (6), 743-751

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Procollagen C-endopeptidase enhancer 1

Protein Size: 449

Purification: Affinity Purified
More Information
SKU AVIARP56378_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56378_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5118
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×