PDE1C Antibody - middle region : FITC

PDE1C Antibody - middle region : FITC
SKU
AVIARP56615_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE1C

Key Reference: Vandeput,F., (2007) J. Biol. Chem. 282 (45), 32749-32757

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDE1C protein EMBL AAH22479.1

Protein Size: 634

Purification: Affinity Purified
More Information
SKU AVIARP56615_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56615_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5137
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×