PDE1C Antibody - middle region : HRP

PDE1C Antibody - middle region : HRP
SKU
AVIARP56615_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE1C

Key Reference: Vandeput,F., (2007) J. Biol. Chem. 282 (45), 32749-32757

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PDE1C protein EMBL AAH22479.1

Protein Size: 634

Purification: Affinity Purified
More Information
SKU AVIARP56615_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56615_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5137
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×