PDE1C Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDE1C

Key Reference: Vandeput,F., (2007) J. Biol. Chem. 282 (45), 32749-32757

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Protein Size: 634

Purification: Affinity Purified

• SKU: AVIARP53563_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53563_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5137
• Host: Rabbit
• Conjugate: Conjugated, Biotin