Pde4d Antibody - N-terminal region : Biotin

Pde4d Antibody - N-terminal region : Biotin
SKU
AVIARP56672_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Pde4d hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Protein Size: 747

Purification: Affinity Purified
More Information
SKU AVIARP56672_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56672_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 238871
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×