Pde4d Antibody - N-terminal region : HRP

Pde4d Antibody - N-terminal region : HRP
SKU
AVIARP56672_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pde4d hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Protein Size: 747

Purification: Affinity Purified
More Information
SKU AVIARP56672_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56672_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 238871
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×