PDE6A Antibody - N-terminal region : Biotin

PDE6A Antibody - N-terminal region : Biotin
SKU
AVIARP56111_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes the cyclic-GMP (cGMP)-specific phosphodiesterase 6A alpha subunit, expressed in cells of the retinal rod outer segment. The phosphodiesterase 6 holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by phosphodiesterase 6A cGMP hydrolysis and guanylate cyclase cGMP synthesis. The protein is a subunit of a key phototransduction enzyme and participates in processes of transmission and amplification of the visual signal. Mutations in this gene have been identified as one cause of autosomal recessive retinitis pigmentosa.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PDE6A

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha

Protein Size: 779

Purification: Affinity Purified
More Information
SKU AVIARP56111_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56111_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5145
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×