PDE7B Antibody - middle region : Biotin

PDE7B Antibody - middle region : Biotin
SKU
AVIARP55364_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE7B

Key Reference: Gardner,C., (2000) Biochem. Biophys. Res. Commun. 272 (1), 186-192

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 7B

Protein Size: 450

Purification: Affinity Purified
More Information
SKU AVIARP55364_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55364_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27115
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×