PDXP Antibody - middle region : FITC

PDXP Antibody - middle region : FITC
SKU
AVIARP57385_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDXP

Key Reference: Gohla,A., (2005) Nat. Cell Biol. 7 (1), 21-29

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pyridoxal phosphate phosphatase

Protein Size: 296

Purification: Affinity Purified
More Information
SKU AVIARP57385_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57385_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57026
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×