Pepd Antibody - middle region : FITC

Pepd Antibody - middle region : FITC
SKU
AVIARP56087_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Pepd splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. It plays an important role in collagen metabolism because of the high level of iminoacids in collagen.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: YSRGGMRHTSYTCICCSGENAAVLHYGHAGAPNDRTIKDGDICLFDMGGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified
More Information
SKU AVIARP56087_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56087_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 18624
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×