PEPD Antibody - middle region : HRP

PEPD Antibody - middle region : HRP
SKU
AVIARP56088_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-74 DC395475.1 1-74 75-101 DC385464.1 1-27 102-2018 BC015027.1 1-1917

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEPD

Key Reference: Surazynski,A., (2008) Int. J. Cancer 122 (6), 1435-1440

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified
More Information
SKU AVIARP56088_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56088_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5184
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×