PEX7 Antibody - N-terminal region : HRP

PEX7 Antibody - N-terminal region : HRP
SKU
AVIARP56091_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PEX7

Key Reference: Arning,L., (er) J. Mol. Med. (2008) In press

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peroxisomal targeting signal 2 receptor

Protein Size: 323

Purification: Affinity Purified
More Information
SKU AVIARP56091_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56091_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5191
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×