PFKFB4 Antibody - N-terminal region : Biotin

PFKFB4 Antibody - N-terminal region : Biotin
SKU
AVIARP56584_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFKFB4

Key Reference: Bobarykina,A.Y., (2006) Acta Biochim. Pol. 53 (4), 789-799

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4

Protein Size: 469

Purification: Affinity Purified
More Information
SKU AVIARP56584_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56584_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5210
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×