PGM3 Antibody - middle region : HRP

PGM3 Antibody - middle region : HRP
SKU
AVIARP56756_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGM3

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Phosphoacetylglucosamine mutase

Protein Size: 542

Purification: Affinity Purified
More Information
SKU AVIARP56756_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56756_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5238
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×