PGM3 Antibody - N-terminal region : Biotin

PGM3 Antibody - N-terminal region : Biotin
SKU
AVIARP56755_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGM3

Key Reference: Woo,S.Y., (2007) J. Biol. Chem. 282 (35), 25604-25612

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoacetylglucosamine mutase

Protein Size: 542

Purification: Affinity Purified
More Information
SKU AVIARP56755_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56755_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5238
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×