PH-4 Antibody - middle region : FITC

PH-4 Antibody - middle region : FITC
SKU
AVIARP57762_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PH-4

Key Reference: Koivunen,P., (2007) J. Biol. Chem. 282 (42), 30544-30552

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane prolyl 4-hydroxylase

Protein Size: 502

Purification: Affinity Purified
More Information
SKU AVIARP57762_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57762_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54681
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×