PH-4 Antibody - middle region : HRP

PH-4 Antibody - middle region : HRP
SKU
AVIARP57763_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PH-4

Key Reference: Koivunen,P., (2007) J. Biol. Chem. 282 (42), 30544-30552

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transmembrane prolyl 4-hydroxylase

Protein Size: 502

Purification: Affinity Purified
More Information
SKU AVIARP57763_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57763_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54681
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×