Phkg1 Antibody - N-terminal region : FITC

Phkg1 Antibody - N-terminal region : FITC
SKU
AVIARP56679_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phkg1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFSSEEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform

Protein Size: 388

Purification: Affinity Purified
More Information
SKU AVIARP56679_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56679_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29353
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×