PHLDA1 Antibody - middle region : Biotin

PHLDA1 Antibody - middle region : Biotin
SKU
AVIARP54809_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA1

Key Reference: Nagai,M.A., (2007) Breast Cancer Res. Treat. 106 (1), 49-56

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pleckstrin homology-like domain family A member 1

Protein Size: 401

Purification: Affinity Purified
More Information
SKU AVIARP54809_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54809_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22822
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×