PHLDA2 Antibody - middle region : HRP

PHLDA2 Antibody - middle region : HRP
SKU
AVIARP58237_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin homology-like domain family A member 2

Protein Size: 152

Purification: Affinity Purified
More Information
SKU AVIARP58237_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58237_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 7262
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×