PHLDA3 Antibody - N-terminal region : HRP

PHLDA3 Antibody - N-terminal region : HRP
SKU
AVIARP54891_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact function of PHLDA3 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHLDA3

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pleckstrin homology-like domain family A member 3

Protein Size: 127

Purification: Affinity Purified
More Information
SKU AVIARP54891_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54891_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23612
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×