Phpt1 Antibody - C-terminal region : Biotin

Phpt1 Antibody - C-terminal region : Biotin
SKU
AVIARP54984_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Phpt1 exhibits phosphohistidine phosphatase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Phpt1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 14 kDa phosphohistidine phosphatase

Protein Size: 124

Purification: Affinity Purified
More Information
SKU AVIARP54984_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54984_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 75454
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×