PHYH Antibody - middle region : FITC

PHYH Antibody - middle region : FITC
SKU
AVIARP56682_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have b

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHYH

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phytanoyl-CoA dioxygenase, peroxisomal

Protein Size: 338

Purification: Affinity Purified
More Information
SKU AVIARP56682_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56682_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5264
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×